- Recombinant Zea mays Chlorophyll a-b binding protein M9, chloroplastic (CAB-M9)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1190439
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 28,041 Da
- E Coli or Yeast
- 33-265
- light harvesting chlorophyll a/b binding protein3
- cab-m9
- Chlorophyll a-b binding protein M9, chloroplastic (CAB-M9)
Sequence
RKTAAKAKPAASSGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVVDPLYPGGTFDPLGLADDPEAFADVKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK